The short version of metabolic modulator fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-10. Anything still debated is marked as such rather than presented as settled.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
SR9009 is a synthetic small molecule developed as a REV-ERB agonist. It binds to REV-ERBα and REV-ERBβ, nuclear receptors that help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, the compound alters lipid and glucose handling and influences skeletal muscle oxidative capacity. Its exact effects in humans remain largely uncharacterized because controlled clinical trials have not been reported. The molecule is frequently described in preclinical literature as a metabolic modulator.
Research interest in SR9009 grew from studies showing improved running endurance in mice after short treatment periods. Those experiments linked the compound to increased mitochondrial content and fatty acid oxidation in muscle, but the findings come from animal models and specific dosing schedules. Independent replication has been limited, and the pathways connecting REV-ERB activation to exercise performance are still being mapped. Whether similar responses occur in humans is an open question.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved for human use | Investigational status in most countries |
| Sports status | Prohibited by WADA | Classified as non-approved or metabolic modulator |
| Common analytical method | LC-MS/MS | Used for trace detection in biological samples |
| Typical test matrices | Urine and blood | Sample choice depends on testing program |
| Human trial data | None published | Effects and safety are not established |
In laboratory settings, SR9009 is commonly identified by its molecular structure and its interaction with REV-ERB receptors. Vendors may list it under synonyms such as Stenabolic or REV-ERB agonist, but those names do not define purity or identity. Analytical confirmation typically uses high-performance liquid chromatography with ultraviolet detection or liquid chromatography–mass spectrometry. A reference standard is needed to compare retention time and mass spectrum, because the compound can be confused with related research chemicals.
Handling practices for SR9009 focus on minimizing degradation and contamination. The solid is generally stored desiccated at or below -20 °C, protected from light and moisture. Stock solutions are often prepared in dimethyl sulfoxide or ethanol, then aliquoted to avoid repeated freeze–thaw cycles. Aqueous solubility is low, so formulations for animal studies may require cosolvents or suspending agents. Personnel should follow institutional chemical safety procedures, because toxicological data for humans are incomplete.
Regulatory status varies by country and intended use. Major drug agencies have not granted marketing authorization for SR9009 as a medicine, and it is not listed as a controlled substance in many jurisdictions. It is often sold as a research chemical, a category that may fall outside pharmaceutical manufacturing rules. Buyers should verify local laws and supplier documentation, including certificates of analysis. The lack of standardized quality controls raises concerns about identity, purity, and actual content in products marketed online.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
The mechanism of action involves binding to REV-ERB receptors and recruiting corepressor complexes, which represses target gene transcription. This contrasts with many nuclear receptor agonists that activate transcription. Downstream effects may include changes in autophagy, mitochondrial biogenesis, and lipid handling, but the precise pathways remain an active area of study. Whether these molecular events translate into meaningful physiological effects in humans is unresolved. Most evidence comes from cultured cells and rodent models rather than human participants.
Laboratory samples of SR9009 are typically supplied as a white to off-white powder. The compound dissolves readily in organic solvents such as dimethyl sulfoxide and ethanol, while its solubility in water is low. Because of this solubility profile, researchers often prepare concentrated stock solutions in an organic solvent before diluting them into aqueous assay buffers. Light exposure, moisture, and repeated freeze-thaw cycles can degrade many small molecules, so handling procedures usually aim to minimize these factors. Purity is commonly checked before use.
Storage conditions for research-grade SR9009 generally involve a freezer at approximately minus twenty degrees Celsius, sometimes lower for long-term preservation. Containers should remain tightly closed and protected from light. Desiccants may be used to limit moisture uptake. Solutions are often stored in aliquots to avoid repeated warming and cooling. Stability data for the compound under various conditions are limited, so laboratories typically follow supplier recommendations and verify performance through periodic analytical checks rather than assuming indefinite stability.
Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.
SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.
REV-ERB proteins typically suppress gene expression by recruiting corepressor complexes to DNA response elements. SR9009 binds these receptors and strengthens that repressive action in cell-based assays. Studies in rodents have reported changes in lipid handling, mitochondrial function, and exercise capacity after treatment. Such findings are often cited as evidence for metabolic effects, but species differences and limited pharmacokinetic data make direct translation to humans uncertain. Researchers continue to examine which effects are robust and which depend on specific experimental conditions.
SR9009 is frequently discussed alongside other REV-ERB ligands, including synthetic agonists and natural heme-related molecules. Its selectivity for REV-ERB over related nuclear receptors has been measured in binding and reporter assays, though off-target activity at higher concentrations is possible. The compound is prohibited in sport by the World Anti-Doping Agency, and it is not approved for any medical use in major jurisdictions. Products sold online may be labeled as research chemicals, and their identity and purity are not guaranteed by regulatory review.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC, EDAC or EDCI) is a water-soluble carbodiimide usually handled as the hydrochloride, which is a white solid. It is typically employed in the 4.0-6.0 pH range. It is generally used as a carboxyl activating agent for the coupling of primary amines to yield amide bonds. While other carbodiimides like dicyclohexylcarbodiimide (DCC) or diisopropylcarbodiimide (DIC) are also employed for this purpose, EDC has the advantage that the urea byproduct formed (often challenging to remove in the case of DCC or DIC) can be washed away from the amide product using dilute acid. Additionally, EDC can also be used to activate phosphate groups in order to form phosphomonoesters and phosphodiesters. Common uses for this carbodiimide include peptide synthesis, protein crosslinking to nucleic acids, but also in the preparation of immunoconjugates. EDC is often used in combination with N-hydroxysuccinimide (NHS) for the immobilisation of large biomolecules. Recent work has also used EDC to assess the structure state of uracil nucleobases in RNA.
Abdurozik Savriqul Muhammadroziqi (Tajik: Абдурозиқ Савриқул Муҳаммадрозиқӣ, [æbdurɑˈzɯq sævrɯˈqul muˌɦæmːædrɑzɯˈqiː], born 23 September 2003), known professionally as Abdu Rozik, is a Tajikistani playback singer and social media influencer based in Dubai, UAE. In 2022, he participated in Bigg Boss 16 and later in Laughter Chefs – Unlimited Entertainment 2. As a child, Rozik was diagnosed with dwarfism, a growth hormone deficiency which could be cured with appropriate medical treatment. However, his family could not afford to have him treated, leading to his stunted growth. Due to his family's poverty, Rozik was often out of school. He sang for tips in markets and on streets of Panjakent in Tajikistan; along with his family, Rozik also had a beloved pet cat named Renzo, a British Shorthair, who brought him a lot of joy during difficult times.
C-reactive protein (CRP), a marker of systemic inflammation, is also increased in obstructive sleep apnea (OSA). CRP and interleukin-6 (IL-6) levels were significantly higher in patients with OSA compared to obese control subjects. Patients with OSA have higher plasma CRP concentrations that increased corresponding to the severity of their apnea-hypopnea index score. Treatment of OSA with CPAP (continuous positive airway pressure) significantly alleviated the effect of OSA on CRP and IL-6 levels.
Sources: en.wikipedia.org
Immunomodulating agents regulate the immune system's response and are produced by various immune cells. These agents include the following agents and markers: The BCG vaccine has been used against tuberculosis, mycobacteria, and various cancers in the form of vaccination as an initial immune system stimulant. In cancer, the anti-tumor immunological effects are elicited by the host's immune response and the BCG infection against the tumor cells, most commonly in bladder cancer. The immune activation allows for further recognition and elimination of malignant tumor cells. Specific active immunotherapy administers a specific antigen as the therapy. The therapy allows the host to create an antigen-specific response with the development of antibodies, proliferation of cytotoxic T lymphocyte responses, or both, directed at the desired pathogen or malignant tumor cell in the case of cancer therapy.
Biohazardous safety issues are identified with specified labels, signs and paragraphs established by the American National Standards Institute (ANSI). Today, ANSI Z535 standards for biohazards are used worldwide and should always be used appropriately within ANSI Z535 Hazardous Communications (HazCom) signage, labeling and paragraphs. The goal is to help workers rapidly identify the severity of a biohazard from a distance and through colour and design standardization. Biological hazard symbol design:
The first automated insulin delivery system was known as the Biostator. Currently available AID systems fall into three broad classes based on their capabilities. The first systems released can only halt insulin delivery (predictive low glucose suspend) in response to already low or predicted low glucose. Hybrid Closed Loop systems can modulate delivery both up and down, although users still initiate insulin doses (boluses) for meals and typically "announce" or enter meal information. Fully Closed Loops require no manual insulin delivery actions or announcement for meals. A step forward from threshold suspend systems, predictive low glucose suspend (PLGS) systems use a mathematical model to extrapolate predicted future blood sugar levels based on recent past readings from a CGM. This allows the system to reduce or halt insulin delivery prior to a predicted hypoglycemic event.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The American Society for Mass Spectrometry (ASMS) is a professional association based in the United States that supports the scientific field of mass spectrometry. As of 2018, the society had approximately 10,000 members primarily from the US, but also from around the world. The society holds a large annual meeting, typically in late May or early June as well as other topical conferences and workshops. The society publishes the Journal of the American Society for Mass Spectrometry.
Proteomics permits the quantitative analysis and detection of changes to proteins or protein biomarkers. Protein biomarkers detect a variety of biological changes, such as protein-protein interactions, post-translational modifications and immunological responses. Protein biomarkers are widely used in diagnostics due to their direct involvement in cellular functions and pathways. Protein biomarkers can provide direct information about the functional state of cells and tissues, offering insights into disease mechanisms. Techniques such as mass spectrometry, immunohistochemistry, ELISA, and flow cytometry are employed to detect protein biomarkers, which can indicate protein presence and quantification. For example, in about 20% of breast cancers, the cancer cells have an overexpression of the HER2 gene, leading to more aggressive tumor growth. HER2 status can be determined using IHC and FISH. HER2-positive breast cancers are treated with targeted therapies that specifically target the HER2 protein, inhibiting the growth of cancer cells.
Clustal Omega is a multiple sequence alignment (MSA) tool that enables to find an optimal alignment of at least three and maximum of 4000 input DNA and protein sequences. Clustal Omega algorithm employs two profile Hidden Markov models (HMMs) to derive the final alignment of the sequences. The output of the Clustal Omega may be visualized in a guide tree (the phylogenetic relationship of the best-pairing sequences) or ordered by the mutual sequence similarity between the queries. The main advantage of Clustal Omega over other MSA tools (Muscle, ProbCons) is its efficiency, while maintaining a significant accuracy of the results.
Sources: en.wikipedia.org
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.
Sports authorities prohibit it because it is not approved for human use and has potential performance-enhancing effects. It appears on anti-doping lists under non-approved or metabolic modulator categories.
Detection usually uses liquid chromatography-tandem mass spectrometry. The method targets the parent compound or its metabolites in urine or blood.
It is a synthetic REV-ERB agonist used mainly in preclinical research. It is not an approved medicine for human use.